top of page

Recombinant Brazzein (protein sweetener) 10mg

SKU BBSBRAZZEIN10MG
Price

C$220.00

Excluding GST/HST

RUO Product (Research Use Only)

 

Brazzein is a small protein derived from the African plant Pentadiplandra brazzeana. It has sweet taste and is very heat-stable.

 

Sweet taste has been shown to be mediated by a heterodimeric G protein coupled receptor composed of two proteins, T1R2 and T1R3. These proteins have significant homology to a brain metabotropic glutamate receptor, mGluR1, which functions as a homodimer.

 

The ligand binding domain has been compared to a clamshell or a Venus flytrap, having two lobes that form the glutamate binding site. In the absence of ligand, both monomers have very open binding sites. In the ligand-activated form, one mGluR1 chain exhibits a rather closed conformation, and the other has an open binding site.

Quantity

Specification

Gene Aliases:  DEF_PENBA

Accession number:   P56552

Amino acid sequence:  DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY

Species:   Pentadiplandra brazzeana

Expression Host / source:  Yeast (animal free media and environment)

Tag: no tags

 

Endotoxins:  <0.2 EU/μg of protein as determined by the LAL method.

Buffer System: Potassium Phosphate-buffer, pH 7.0

Approx. MW:  6.4 kDa

Purity: 98%

Formulation: lyophilized from solution in PBS buffer with initial concentration 100ug/ul
 

Reconstitution protocol: Spin the vial briefly, add distilled sterile water to a concentration of 1 mg/ml.

Storage and Stability

lyophilized Brazzein is stable for at least one year at -200 oC. Upon reconstitution Brazzein can be stored at +40 oC for 1 week or at -200 oC for 6 months.

bottom of page