Recombinant Brazzein (protein sweetener) 10mg
$220.00
Excluding GST/HST
RUO Product (Research Use Only)
Brazzein is a small protein derived from the African plant Pentadiplandra brazzeana. It has sweet taste and is very heat-stable.
Sweet taste has been shown to be mediated by a heterodimeric G protein coupled receptor composed of two proteins, T1R2 and T1R3. These proteins have significant homology to a brain metabotropic glutamate receptor, mGluR1, which functions as a homodimer.
The ligand binding domain has been compared to a clamshell or a Venus flytrap, having two lobes that form the glutamate binding site. In the absence of ligand, both monomers have very open binding sites. In the ligand-activated form, one mGluR1 chain exhibits a rather closed conformation, and the other has an open binding site.
Quantity
Specification
Gene Aliases: DEF_PENBA
Accession number: P56552
Amino acid sequence: DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Species: Pentadiplandra brazzeana
Expression Host / source: Yeast (animal free media and environment)
Tag: no tags
Endotoxins: <0.2 EU/μg of protein as determined by the LAL method.
Buffer System: Potassium Phosphate-buffer, pH 7.0
Approx. MW: 6.4 kDa
Purity: 98%
Formulation: lyophilized from solution in PBS buffer with initial concentration 100ug/ul
Reconstitution protocol: Spin the vial briefly, add distilled sterile water to a concentration of 1 mg/ml.
Storage and Stability
lyophilized Brazzein is stable for at least one year at -200 oC. Upon reconstitution Brazzein can be stored at +40 oC for 1 week or at -200 oC for 6 months.

